Protein Info for Synpcc7942_0439 in Synechococcus elongatus PCC 7942

Name: chlM
Annotation: Mg-protoporphyrin IX methyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02021: magnesium protoporphyrin O-methyltransferase
  • amino acids 7 to 224 (218 residues), 248.4 bits, E=2.5e-78
• PF06325: PrmA
  • amino acids 41 to 131 (91 residues), 30 bits, E=1.5e-10
• PF05175: MTS
  • amino acids 55 to 131 (77 residues), 26.5 bits, E=1.9e-09
• PF13489: Methyltransf_23
  • amino acids 58 to 207 (150 residues), 48.1 bits, E=4.5e-16
• PF13847: Methyltransf_31
  • amino acids 62 to 155 (94 residues), 43.4 bits, E=1.2e-14
• PF13649: Methyltransf_25
  • amino acids 65 to 152 (88 residues), 59 bits, E=2.5e-19
• PF08242: Methyltransf_12
  • amino acids 66 to 151 (86 residues), 45.6 bits, E=3.9e-15
• PF08241: Methyltransf_11
  • amino acids 66 to 143 (78 residues), 45.1 bits, E=5.3e-15
• PF07109: Mg-por_mtran_C
  • amino acids 131 to 227 (97 residues), 123.9 bits, E=1.1e-39

Best Hits

KEGG orthology group: K03428, magnesium-protoporphyrin O-methyltransferase [EC: 2.1.1.11] (inferred from 100% identity to syc:syc1079_d)

Predicted SEED Role

"Mg-protoporphyrin O-methyltransferase (EC 2.1.1.11)" in subsystem Chlorophyll Biosynthesis (EC 2.1.1.11)

MetaCyc Pathways

• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (9/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (9/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (6/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (11/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.11

Sequence Analysis Tools

See Q31R48 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Synpcc7942_0439 Mg-protoporphyrin IX methyl transferase (Synechococcus elongatus PCC 7942)
MTALDDKTIVRDYFNATGFDRWSRIYGDGEVNFVQKNIRIGHQRTVDTVLSWLEADGNLS
DRSFCDAGCGVGSLSLPLAQRGAQAVYASDISAKMVEEARERASQIPNLNNIQLEVSDLA
SLSGRYDTVICLDVLIHYPESDAAAMLSHLCSLAEQRVLVSFAPKSPVLNVLKRIGQFFP
GASKTTRAYQHSETAIAAALAANGFQVQRRAFNKAPFYFSLLLEAVRTA