Protein Info for Synpcc7942_0370 in Synechococcus elongatus PCC 7942

Name: metY
Annotation: O-acetylhomoserine/O-acetylserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01326: O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
  • amino acids 4 to 429 (426 residues), 651.6 bits, E=2.2e-200
• PF01053: Cys_Met_Meta_PP
  • amino acids 6 to 429 (424 residues), 436.3 bits, E=1.5e-134
• PF00155: Aminotran_1_2
  • amino acids 58 to 182 (125 residues), 31.9 bits, E=1.7e-11
• PF01041: DegT_DnrJ_EryC1
  • amino acids 59 to 181 (123 residues), 38.2 bits, E=2.1e-13
• PF00266: Aminotran_5
  • amino acids 82 to 214 (133 residues), 34 bits, E=3.4e-12

Best Hits

Swiss-Prot: 57% identical to METY_LEPME: O-acetyl-L-homoserine sulfhydrylase (metY) from Leptospira meyeri

KEGG orthology group: K01740, O-acetylhomoserine (thiol)-lyase [EC: 2.5.1.49] (inferred from 100% identity to syf:Synpcc7942_0370)

MetaCyc: 57% identical to O-acetylhomoserine sulfhydrylase (Leptospira meyeri)
O-acetylhomoserine aminocarboxypropyltransferase. [EC: 2.5.1.49]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• L-methionine biosynthesis III (3/4 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• L-methionine biosynthesis I (3/5 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• homocysteine and cysteine interconversion (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

See Q31RB7 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Synpcc7942_0370 O-acetylhomoserine/O-acetylserine sulfhydrylase (Synechococcus elongatus PCC 7942)
MSQHLETLALHAGQKPDPTTGSRAVPIYQTTSYVFEDAEHAANLFALKAFGNIYTRLMNP
TTDVLEQRLAALHGGTGAVATSSGQAAIFYAIAAITSAGQNIISTTNLYGGTINLFRHTL
KRFGIEVRFVDSSDASSVAAAIDENTRLVYTESIGNPKGNVDDFEAIAAIAHDSGIPFIV
DNTVSPPPLFNPLEHGADVVVLSLTKLAGGHGTSLGGIVIEKGDFPWNNGKFPEIAGPDP
SYHGVNFWDAFGNHPEAVAPGLAYVLKIRTGLLRDIGATLSPFNAQQVLLGVETLPLRAE
RHVRNAQAVAEWLERHPLVTWVNYPGLPSHPDYDRAQRYLPNGAGAILGFGVQGGLEAGK
RFISAVKLASNLANVLDAKTLVIHPASTTHQQLSPEEQAAAGVSPDFVRLSVGLEHLDDI
LADLDQALQASQVA