Protein Info for Synpcc7942_0356 in Synechococcus elongatus PCC 7942

Name: ycf33
Annotation: conserved hypothetical protein YCF33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 74 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details PF05421: DUF751" amino acids 4 to 63 (60 residues), 90 bits, see alignment E=6.4e-30

Best Hits

Swiss-Prot: 32% identical to YCF33_SKECO: Uncharacterized protein ycf33 (ycf33) from Skeletonema costatum

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0356)

Predicted SEED Role

"Expressed protein possibly involved in photorespiration" in subsystem Photorespiration (oxidative C2 cycle)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RD1 at UniProt or InterPro

Protein Sequence (74 amino acids)

>Synpcc7942_0356 conserved hypothetical protein YCF33 (Synechococcus elongatus PCC 7942)
MKDFFVNVLRYPRYFITFLLGIFYSIYQWVRPMVRNPVAAWALLGFGVSTLAFLSLTLRA
MLGQAIGEPGSLGG