Protein Info for Synpcc7942_0356 in Synechococcus elongatus PCC 7942
Name: ycf33
Annotation: conserved hypothetical protein YCF33
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 32% identical to YCF33_SKECO: Uncharacterized protein ycf33 (ycf33) from Skeletonema costatum
KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0356)Predicted SEED Role
"Expressed protein possibly involved in photorespiration" in subsystem Photorespiration (oxidative C2 cycle)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31RD1 at UniProt or InterPro
Protein Sequence (74 amino acids)
>Synpcc7942_0356 conserved hypothetical protein YCF33 (Synechococcus elongatus PCC 7942) MKDFFVNVLRYPRYFITFLLGIFYSIYQWVRPMVRNPVAAWALLGFGVSTLAFLSLTLRA MLGQAIGEPGSLGG