Protein Info for Synpcc7942_0353 in Synechococcus elongatus PCC 7942

Annotation: Na+-dependent transporter-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details PF13593: SBF_like" amino acids 10 to 273 (264 residues), 61 bits, see alignment E=1.3e-20 PF01758: SBF" amino acids 38 to 216 (179 residues), 159.8 bits, see alignment E=6.7e-51

Best Hits

Swiss-Prot: 42% identical to YOCS_BACSU: Uncharacterized sodium-dependent transporter YocS (yocS) from Bacillus subtilis (strain 168)

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 100% identity to syc:syc1160_c)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RD4 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Synpcc7942_0353 Na+-dependent transporter-like (Synechococcus elongatus PCC 7942)
MADRLTNLFPFWLLLIGAIALRWPQIFIGLNQGNLPVLILTLVMLGMGLTLSLDDFQRVS
RLPRAVLTGFCAQYLIMPFLGWAIGAALQLPTALAVGLILVGTCPGGTASNLITYIARAD
VALSVVMTLASTLAAVVMTPLLTQFLAGAYVPVNGWLLFAQTLQVVILPVAIGVALNRWT
PRLVRQVLPIAPLLSVVGICLICAATFSANAEAIVQQGRQMLLGVFLLHSLGFALGFGFA
KLFGYSQAIARTIAIEVGMQNSGLAIILARQAFPLLPLAAAIGAISGVMHSLVGSFLAVI
WRSQAQRQSEAVQPHNSLTM