Protein Info for Synpcc7942_0345 in Synechococcus elongatus PCC 7942

Name: birA
Annotation: Biotin--acetyl-CoA-carboxylase ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase
  • amino acids 20 to 222 (203 residues), 146.2 bits, E=5.8e-47
• PF03099: BPL_LplA_LipB
  • amino acids 23 to 141 (119 residues), 73.6 bits, E=7.6e-25

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 100% identity to syc:syc1168_d)

Predicted SEED Role

No annotation

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

See Q31RE2 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Synpcc7942_0345 Biotin--acetyl-CoA-carboxylase ligase (Synechococcus elongatus PCC 7942)
MVCLNLQQQAQQAGIRYRLRTIAVTDSTNAQLWQQADRHEQVLIAAQQRAGRGQQGRSWL
SPLGGLYLSLGLDLDLPLSESARLIFGAAWGVAQSLRSQVPVQLKWPNDLVLDDRKLGGI
LVETRSQGDRLREAVIGLGLNGSNPVPETGIALQSVSTAWADLPDLAIAVLQGLQTGLDQ
WLADDWETLIPLYDQWLYRRSDRLTWQGQIVTLLGIDPSGGLRLQGRDRPWVIVQPGDLS
LWPWQHDPKTDPVTHQ