Protein Info for Synpcc7942_0343 in Synechococcus elongatus PCC 7942

Name: psb27
Annotation: photosystem II 11 kD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03044: photosystem II protein Psb27" amino acids 7 to 132 (126 residues), 190.7 bits, see alignment E=5.4e-61 PF13326: PSII_Pbs27" amino acids 22 to 128 (107 residues), 88.1 bits, see alignment E=3.5e-29

Best Hits

Swiss-Prot: 62% identical to PSB27_THEEB: Photosystem II lipoprotein Psb27 (psb27) from Thermosynechococcus elongatus (strain BP-1)

KEGG orthology group: K08902, photosystem II Psb27 protein (inferred from 100% identity to syf:Synpcc7942_0343)

Predicted SEED Role

"Photosystem II protein Psb27" in subsystem Photosystem II

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RE4 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Synpcc7942_0343 photosystem II 11 kD protein (Synechococcus elongatus PCC 7942)
MARPLARLFAIVLVAVIGLTACTGGGDSAISGNYRQDTLAVVTSLRNAITLPDDAPEKSA
AQAEARQLINDFAARYRRDSRVSGLSSFTTMQTALNSLAGHYSSYPNRPVPEKLKKRLEK
EFRMVELALNREA