Protein Info for Synpcc7942_0322 in Synechococcus elongatus PCC 7942

Name: ycf44
Annotation: c-type cytochrome biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details PF05140: ResB" amino acids 29 to 296 (268 residues), 221.8 bits, see alignment E=8.6e-70 amino acids 367 to 436 (70 residues), 44.6 bits, see alignment E=4.6e-16

Best Hits

Swiss-Prot: 100% identical to CCS1_SYNP6: Cytochrome c biogenesis protein CcsB (ccsB) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K07399, cytochrome c biogenesis protein (inferred from 100% identity to syc:syc1191_d)

Predicted SEED Role

"Cytochrome c-type biogenesis protein Ccs1/ResB" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RG5 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Synpcc7942_0322 c-type cytochrome biogenesis protein (Synechococcus elongatus PCC 7942)
MTSDPLASPSFADRWRRGQQLFWTWLADLRLAILLLLAIAIASATGTVIEQGQSLAFYQE
NYPTDPALFGFLSWRWILSLGLDHVYRAGWFLGLLILFGASLTACTFRRQWPALRAAQRW
QFYQEPRQFTKLALSASLPQGKLDSLEPLLLQRRYRLFRADDVLYARRGLAGRVGPILVH
AGMLVVLGGAIWGSLGGFYAQEMIPSGETFQVRNIVDAGPWSGSRIPQDWAVKVNRFWID
YAPDGRIDQFYSDLSVVDREGQEQDRQTIHVNQPLRYGGLTFYQADWAIAAAQVRLNNSP
VLQLPMAQLPAAGRIWGTFVPTKPDLSSGVSLIAKDLQGTAVIYGSNGEPLGTLRKGMAI
EVEGIRLSLVDLVGSTGLQIKSDPGIPWVYAGFLFVMVGVVCSYVSHAQVWALEQDGQLY
IGGRSNRALVAFEQEMLAVLAQLDAQSNHSAETAIA