Protein Info for Synpcc7942_0315 in Synechococcus elongatus PCC 7942

Name: purB
Annotation: adenylosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00928: adenylosuccinate lyase
  • amino acids 1 to 429 (429 residues), 564.7 bits, E=6.6e-174
• PF00206: Lyase_1
  • amino acids 7 to 286 (280 residues), 209.2 bits, E=1.1e-65
• PF10397: ADSL_C
  • amino acids 350 to 428 (79 residues), 89 bits, E=2.1e-29

Best Hits

Swiss-Prot: 78% identical to PUR8_SYNY3: Adenylosuccinate lyase (purB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 100% identity to syf:Synpcc7942_0315)

MetaCyc: 42% identical to succinylo-toyocamycin phosphate lyase (Streptomyces rimosus)
4.3.2.-

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• dZTP biosynthesis (3/5 steps found)
• toyocamycin biosynthesis (1/5 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.2

Sequence Analysis Tools

See Q31RH2 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Synpcc7942_0315 adenylosuccinate lyase (Synechococcus elongatus PCC 7942)
LIERYTLPAMGGLWTDTYKLKTWLQVEIAVCEAQAELGYIPADAVETIKAKANFDPARVL
EIEQEVRHDVIAFLTNVNEYVGDAGRYIHLGMTSSDVLDTGLALQMVASVDLLLAETENL
IQAIRWQAQQHRETVMIGRSHGIHAEPITFGFKLAGWLAEMLRNRDRLVQVRQSVAVGKI
SGAVGTYANIEPRVEALTCQKLGLEPDTASTQVVSRDRHAEYVQVLALVAASLERFSVEI
RNLQRSDVLEVEEFFAKGQKGSSAMPHKRNPIRSERISGLARVIRGYAVAALENVALWHE
RDISHSSVERMMLPDCSATLHFMLVEMTELVKTLQVYPENMTRNLNRYGGVVFSQRVLLA
LVDKGLSREEAYRIVQSNAHSAWNHEGGNFRALIEADPTVQAHLSAAEIEDCFAAQHHLR
HLDDVYQRLNI