Protein Info for Synpcc7942_0281 in Synechococcus elongatus PCC 7942

Annotation: probable glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 117 to 142 (26 residues), see Phobius details amino acids 144 to 146 (3 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 90 to 245 (156 residues), 141 bits, see alignment E=1.8e-45

Best Hits

KEGG orthology group: K13685, UDP-N-acetylglucosamine:undecaprenyl-P N-acetylglucosaminyl 1-P transferase [EC: 2.7.8.-] (inferred from 100% identity to syc:syc1232_d)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RK6 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Synpcc7942_0281 probable glycosyltransferase (Synechococcus elongatus PCC 7942)
MTAPAAPTSLYPLLAFCVSALVVVLTTPVVRSLGLQRGLVDQPGERKVHHRPMVRLGGIS
IFLGSLAALLLTWWLGGFGVLPSDREYEIWGVTIGGLVFFLIGLADDFFSLSPITRLLAQ
MTVAAGVWLVGVRIDLLTIPFVGGVYVLPEWLSLPVTVLWLVGMTNAINWIDGLDGLAAG
VSGISAVILLIVALAVQQPAAALVAAALAGGCLGFLRYNFNPAKIFMGDGGSYFIGFTLA
GVGVIGLVKSLTTFAVLLPYLILAVPMLDMVTVILDRLRSGQSPFKADKRHLHHRLLDAG
FSHRRTVVLIYGLTLCAGSWALAFANIPSGYAYAIASTLLVIVLFWRSRQRSRRSLP