Protein Info for Synpcc7942_0264 in Synechococcus elongatus PCC 7942

Name: uppS
Annotation: Undecaprenyl pyrophosphate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 21 to 248 (228 residues), 333.7 bits, see alignment E=2.4e-104 PF01255: Prenyltransf" amino acids 28 to 248 (221 residues), 299.9 bits, see alignment E=5.4e-94

Best Hits

Swiss-Prot: 74% identical to ISPT_SYNY3: Isoprenyl transferase (uppS) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 100% identity to syc:syc1249_c)

MetaCyc: 48% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RM3 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Synpcc7942_0264 Undecaprenyl pyrophosphate synthetase (Synechococcus elongatus PCC 7942)
MTSVSNCDLRQRPPDLLPDRLPSHVAVIMDGNGRWAKQRGLPRIMGHRRGVDSLKQLLRC
CDDWGIGALTAYAFSTENWGRPHEEVDFLMTLFERVLRRELQELMAENVRIRFVGDLENL
PTSLQREIDRATSATAQNDGIRFTVATNYGGRQELLKACREIAAQVQQGQLAIDAIDESL
LSSHLYTAGVTDPDLLIRTSGEKRLSNFLLWQLAYAEIYVTDTLWPDFDRYEFYLALRDF
QSRQRRFGRLT