Protein Info for Synpcc7942_0263 in Synechococcus elongatus PCC 7942

Annotation: Protein of unknown function DUF147

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details TIGR00159: TIGR00159 family protein" amino acids 20 to 262 (243 residues), 271.9 bits, see alignment E=2.4e-85 PF02457: DAC" amino acids 128 to 246 (119 residues), 134 bits, see alignment E=9.9e-44

Best Hits

Swiss-Prot: 36% identical to DACA_LISMO: Diadenylate cyclase (dacA) from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0263)

Predicted SEED Role

"Diadenylate cyclase spyDAC; Bacterial checkpoint controller DisA with nucleotide-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RM4 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Synpcc7942_0263 Protein of unknown function DUF147 (Synechococcus elongatus PCC 7942)
MGDWLTQTGTWLSSGSGLLLRNALDISLVLILFYVILVLIGERRTLWMVRGFIVLMLAAA
ISSRLNLTLLNFVLNNLVIGSAVAMAVLLQSEFRRFLEQLGRGEVAALFRPNARSQPRAG
GVAEEIIEAVKELSQNRTGALIVIETGSSIDDRDVNSLGVRLNAEVSSELLQSIFQTSTQ
LHDGAVLISENRVVAAGVILPLSEQVISRRLGTRHRAALGITERLNQCICIVVSEETGSI
SLAEQGILNRPLTSSKLKALLEERMSLAAQREVIAPDLRSLSRYLYSSSRSVLRHLNLLG
SRRGRP