Protein Info for Synpcc7942_0256 in Synechococcus elongatus PCC 7942

Name: ama
Annotation: Peptidase M20D, amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 33 to 395 (363 residues), 393.7 bits, E=4.2e-122
• PF01546: Peptidase_M20
  • amino acids 91 to 404 (314 residues), 154.4 bits, E=3.9e-49
• PF07687: M20_dimer
  • amino acids 205 to 294 (90 residues), 34 bits, E=2.4e-12

Best Hits

Swiss-Prot: 38% identical to CBPX2_SACS2: Thermostable carboxypeptidase 2 (cpsA2) from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

KEGG orthology group: K01436, amidohydrolase [EC: 3.5.1.-] (inferred from 100% identity to syf:Synpcc7942_0256)

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase homolog (EC 3.5.1.18)" (EC 3.5.1.18)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-lysine biosynthesis I (7/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.18

Sequence Analysis Tools

See Q31RN1 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Synpcc7942_0256 Peptidase M20D, amidohydrolase (Synechococcus elongatus PCC 7942)
VGQSPCLLTIMLLLSQELPETVRPAVRDRHAQIVAWRQQLHRRPELGFQEQETAAFIAAR
LTELGVSFQAGVAGTGIVAEIAGQRSGPTLAIRADMDALPILEANEIPYRSEIDGRMHAC
GHDGHVAIALGTAACLQANSDFAGRVKIIFQPAEEGPGGAAPMIAEGVLENPAVDAIIGL
HLWNYLPLGKVGVRSGPLMAAVELFDLTIQGRGGHAAIPQNCIDAVLVASQIVTLLQSIV
SRNVDPLHSAVVTIGSLHAGTTYNVIADRAQLKGTVRYFDDRYQGFLQERIEQIVAGVCN
SHGATYELNYRKLYPAVINDSAIADLVRSVAEEVLEPPLGVVPDCQTMGAEDMSYFLQKV
PGCYFFLGSANLDRGLNFPHHHPRFNFDETALALGVELFLRCVERFCR