Protein Info for Synpcc7942_0256 in Synechococcus elongatus PCC 7942

Name: ama
Annotation: Peptidase M20D, amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01891: amidohydrolase" amino acids 33 to 395 (363 residues), 393.7 bits, see alignment E=4.2e-122 PF01546: Peptidase_M20" amino acids 91 to 404 (314 residues), 154.6 bits, see alignment E=3.4e-49 PF07687: M20_dimer" amino acids 205 to 294 (90 residues), 34 bits, see alignment E=2.4e-12

Best Hits

Swiss-Prot: 38% identical to CBPX2_SACS2: Thermostable carboxypeptidase 2 (cpsA2) from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

KEGG orthology group: K01436, amidohydrolase [EC: 3.5.1.-] (inferred from 100% identity to syf:Synpcc7942_0256)

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase homolog (EC 3.5.1.18)" (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RN1 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Synpcc7942_0256 Peptidase M20D, amidohydrolase (Synechococcus elongatus PCC 7942)
VGQSPCLLTIMLLLSQELPETVRPAVRDRHAQIVAWRQQLHRRPELGFQEQETAAFIAAR
LTELGVSFQAGVAGTGIVAEIAGQRSGPTLAIRADMDALPILEANEIPYRSEIDGRMHAC
GHDGHVAIALGTAACLQANSDFAGRVKIIFQPAEEGPGGAAPMIAEGVLENPAVDAIIGL
HLWNYLPLGKVGVRSGPLMAAVELFDLTIQGRGGHAAIPQNCIDAVLVASQIVTLLQSIV
SRNVDPLHSAVVTIGSLHAGTTYNVIADRAQLKGTVRYFDDRYQGFLQERIEQIVAGVCN
SHGATYELNYRKLYPAVINDSAIADLVRSVAEEVLEPPLGVVPDCQTMGAEDMSYFLQKV
PGCYFFLGSANLDRGLNFPHHHPRFNFDETALALGVELFLRCVERFCR