Protein Info for Synpcc7942_0205 in Synechococcus elongatus PCC 7942

Annotation: nicotinamide-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00125: cytidyltransferase-like domain" amino acids 5 to 65 (61 residues), 42 bits, see alignment E=4.2e-15 PF01467: CTP_transf_like" amino acids 7 to 78 (72 residues), 42.9 bits, see alignment E=5.8e-15 PF00293: NUDIX" amino acids 202 to 333 (132 residues), 68.3 bits, see alignment E=7e-23

Best Hits

Swiss-Prot: 61% identical to NADM_SYNY3: Bifunctional NMN adenylyltransferase/Nudix hydrolase (slr0787) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K13522, bifunctional NMN adenylyltransferase/nudix hydrolase [EC: 2.7.7.1 3.6.1.-] (inferred from 100% identity to syf:Synpcc7942_0205)

MetaCyc: 61% identical to nicotinamide mononucleotide adenylyltransferase subunit (Synechocystis sp. PCC 6803)
Nicotinamide-nucleotide adenylyltransferase. [EC: 2.7.7.1]

Predicted SEED Role

"Nicotinamide-nucleotide adenylyltransferase, NadM family (EC 2.7.7.1) / ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) or NAD regulation (EC 2.7.7.1, EC 3.6.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.1.13

Use Curated BLAST to search for 2.7.7.1 or 3.6.1.- or 3.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RT2 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Synpcc7942_0205 nicotinamide-nucleotide adenylyltransferase (Synechococcus elongatus PCC 7942)
MKYDVAVYIGRFQPFHNGHLSVVQRSLEVAQHLLILTGSHLASPDTRNPWSSEEREEMIR
AALPANWQKRVSFIPIRDHLYSDNLWLTEIQQKVLEEAGEEARIVLVGHRKDRSSYYLDL
FPQWDFLEVPRLEAVHSTAIRDAYFSGSEESNYAAALPAGVADYLTAYQQTGRYQWLRDE
ADYIKGYRQAWAVAPYAPTFVTTDAIVIQSGHVLVVRRKARPGKGLIALPGGYIQQDETV
LEGMLRELREETGLKVPKPVLQGSIVENRVFDAPQRSQRGRIITHAFCIHLKPGPLPSVR
GGDDAEKAWWMSLADLYAHEDQFFEDHFQIIQHFVSRT