Protein Info for Synpcc7942_0188 in Synechococcus elongatus PCC 7942

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 TIGR00229: PAS domain S-box protein" amino acids 25 to 149 (125 residues), 63.3 bits, see alignment E=1.2e-21 PF13188: PAS_8" amino acids 27 to 77 (51 residues), 24.5 bits, see alignment 6.6e-09 PF00989: PAS" amino acids 29 to 139 (111 residues), 42.1 bits, see alignment E=2.9e-14 PF08448: PAS_4" amino acids 31 to 143 (113 residues), 40.4 bits, see alignment E=1e-13 PF13426: PAS_9" amino acids 46 to 141 (96 residues), 76 bits, see alignment E=9e-25 PF08447: PAS_3" amino acids 51 to 133 (83 residues), 35.2 bits, see alignment E=4.2e-12 PF00990: GGDEF" amino acids 155 to 304 (150 residues), 29.7 bits, see alignment E=1.8e-10 PF00563: EAL" amino acids 325 to 560 (236 residues), 202.2 bits, see alignment E=3e-63

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0188)

Predicted SEED Role

"Phytochrome-like protein; Cph2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RU9 at UniProt or InterPro

Protein Sequence (578 amino acids)

>Synpcc7942_0188 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Synechococcus elongatus PCC 7942)
MIARPMVPTADQLATDDLSLSDRSRFWLAALEASGQGVAIADATHPDLILTYVNSAFKKL
TGYNAAEALGKSCRFLQGSDRAQPGITTLRQAIRNGQACEVVLRNYRKDGSLFWNQLTIA
PITDGQGKVSHYVALQRDITAFKEQEQALQRQGIYDEHSGLPKRQLFLDRLNQALAWSQF
SGVPGALLLIDLGLPAHLDGSPSLSPDAEENLEIIANRLQAYVRPHETLAHLNHHQFGLL
LLDPDVQLRAEERAHGIQTLIRDRLAGFEGGAHIGIVPLTPETPATVLLQAAEAAAMTAR
SQQQGHLSLEASAIVAAPEQYSRDRDWQQAIAAGELTLALQPQMGLRNRQLRGFEVQLRW
QHPQQGTLLASQLMEHLEQSQHRETVGRWFLDQAGQLLSQWRNSAQFSGLFALSLLPQQW
KSPSFIHDLRSLLETYQIPPEQLELDLPAQSLAESAAESWDWVYAVRDLGIGIGLADFGS
RSIGLYDLRNLPLTTLKLERRFVRGLPDDANDRAIVRGVVAMSQALKVRIVARGVDTVDQ
AKFLARAECDAMQGLAYSAPLTIEEALQVARSPQAPAW