Protein Info for Synpcc7942_0184 in Synechococcus elongatus PCC 7942

Name: pit
Annotation: putative phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 53 to 79 (27 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 117 to 133 (17 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details PF01384: PHO4" amino acids 30 to 349 (320 residues), 211.5 bits, see alignment E=9.6e-67

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to syf:Synpcc7942_0184)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RV3 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Synpcc7942_0184 putative phosphate permease (Synechococcus elongatus PCC 7942)
MIAALLELGSSDRSWLILGVLLCLLFELINGFHDSANTIAPLVYSRVLTPFTAVIWSSLW
NLVGAIASSGAVAFGIVALLPPTTAGQTPDWWAVAALLLVAIAWNWLTWWRGIPLSSSQT
LIGALIGVHWGQLWSEQSWTWQALTVPPLPATLEALLLSPLLGFALAYGLLSLVRSRLPT
SLDQLESLAEPTLTWPTRSSLLLATAGMSFSHGTNDGQKGMGLLLLILATALPDRFATAL
EQHHLPLGIKVTVALSLAIGTLIGWQRITHTLGEAMGDRPLTTAQSLSSAAVTTATILTA
SRWGLPISTTQVLTAGIAGSTLATQTALNRQTIRRLLWTWLITLPIAIGSALLLYSLGRA
IWA