Protein Info for Synpcc7942_0152 in Synechococcus elongatus PCC 7942

Name: mraY
Annotation: phospho-N-acetylmuramoyl-pentapeptide- transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 273 to 300 (28 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 60 to 357 (298 residues), 325.7 bits, see alignment E=1.8e-101 PF10555: MraY_sig1" amino acids 88 to 98 (11 residues), 21.1 bits, see alignment (E = 1.7e-08) PF00953: Glycos_transf_4" amino acids 118 to 286 (169 residues), 118.8 bits, see alignment E=2.3e-38

Best Hits

Swiss-Prot: 100% identical to MRAY_SYNP6: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 100% identity to syf:Synpcc7942_0152)

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31RY5 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Synpcc7942_0152 phospho-N-acetylmuramoyl-pentapeptide- transferase (Synechococcus elongatus PCC 7942)
VSWGQALRNYKPTGQQLFFSLTALLAAAVWGRDRQLDIGLFSPQSQLLALGLGFSLAAIA
GYWVVPLLRRIKAGQFIREDGPQSHLQKAGTPTMGGIFAIPAGLLPALILAGRSPLVWAL
AFVTLAYATIGWLDDWQILRHRNNKGISPKLKLCLQFGAAFLFCLWLISQQGWQGTITTI
TLPFGWSLALSLLFWPLAVFTLVSESNATNLTDGLDGLAGGTGAAVLAGLGLWLAPQDPA
IATFCCSLAGGFLGFLLHNRNPARVFMGDTGSLALGGAIAAIAIVANCLWVLLVMGGLFV
LESISVILQVSYYKATKGPDGKGKRLLRMAPWHHHLELGGWSETQVVASFYGLTLLLIAS
CWLLN