Protein Info for Synpcc7942_0135 in Synechococcus elongatus PCC 7942

Name: rapQ
Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 35 to 161 (127 residues), 52.5 bits, E=1.6e-17
• PF05175: MTS
  • amino acids 35 to 143 (109 residues), 31.5 bits, E=4.7e-11
• PF13489: Methyltransf_23
  • amino acids 42 to 150 (109 residues), 28.4 bits, E=4.5e-10
• PF13847: Methyltransf_31
  • amino acids 47 to 147 (101 residues), 45 bits, E=3.4e-15
• PF13649: Methyltransf_25
  • amino acids 49 to 139 (91 residues), 75.3 bits, E=1.9e-24
• PF08242: Methyltransf_12
  • amino acids 50 to 141 (92 residues), 39.4 bits, E=3e-13
• PF08241: Methyltransf_11
  • amino acids 50 to 143 (94 residues), 71.4 bits, E=2.8e-23

Best Hits

Swiss-Prot: 50% identical to Y829_SYNY3: Uncharacterized methyltransferase sll0829 (sll0829) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to syc:syc1370_d)

Predicted SEED Role

"SAM-dependent methyltransferase sll0829 (UbiE paralog)"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q31S02 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Synpcc7942_0135 Methylase involved in ubiquinone/menaquinone biosynthesis-like (Synechococcus elongatus PCC 7942)
MTSILRPLSYRYAWLYDTVTAISSVPVGGPQRLRQILIEPLTLPRSAQVLDLCCGGGVTT
AALCQRFDNVVGLDAAATAIARAQALTPQASYVVAQAEAMPFAANRFDLIQISVALHEMT
PEQRQQILQEAWRVLKPAGTLAILDLHRPHNPLFWPAIVLFIELFETETAWQLVQSDLIA
QLQAIGFGPIEEKLYSGGSLQALWARKPGDR