Protein Info for Synpcc7942_0091 in Synechococcus elongatus PCC 7942

Name: ycf21
Annotation: conserved hypothetical protein YCF21

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF01947: Rv2949c-like" amino acids 45 to 194 (150 residues), 210.9 bits, see alignment E=4.2e-67

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0091)

Predicted SEED Role

"Ycf21 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31S46 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Synpcc7942_0091 conserved hypothetical protein YCF21 (Synechococcus elongatus PCC 7942)
MASSDRGTSTLQGWHALQTLWRGDQRSVIQGLPHSQLAPAWQLLLLGDGSPTRHLQLLTG
EPTAVDVIEMAPIADQDDGAPPPIRAIAGPRLRRQVWLRTASGQRLAYATSWWTQQRVDA
YLRDRAQPIWANLADLRTELYRDIQGVEYGDSAALSEAFGQTGPFWGRYYLFWHQGQPLT
LIYEVFSPAIATYLGPSTPQPVV