Protein Info for Synpcc7942_0015 in Synechococcus elongatus PCC 7942
Annotation: putative hydroxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y1482_SYNP6: PKHD-type hydroxylase syc1482_d (syc1482_d) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 100% identity to syc:syc1482_d)Predicted SEED Role
"Iron-uptake factor PiuC" in subsystem Transport of Iron
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.14.11.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31SC2 at UniProt or InterPro
Protein Sequence (223 amino acids)
>Synpcc7942_0015 putative hydroxylase (Synechococcus elongatus PCC 7942) VIITIDALLDAAQLNKIQSSLQTAEFIDGRATAGWHAQLVKQNQQLSRTSTLAKSLQEIV QTALQNNALFEAAAYPQRVHSLLFSRYEPGMEYGRHVDNALMGSGDRRDRADLSFTLFLS DPDRYIGGALVIEGACDEQAYRLPAGSLLLYPSSTLHRVDPVEQGYRFACVGWVQSWIRD PAKRELLFDLDTARRSLFTREGKSIEFDLLSKTYANLLRRWSE