Protein Info for SMc04456 in Sinorhizobium meliloti 1021

Annotation: chaperone protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 TIGR02222: export-related chaperone protein CsaA" amino acids 7 to 112 (106 residues), 160.3 bits, see alignment E=6.4e-52 PF01588: tRNA_bind" amino acids 15 to 111 (97 residues), 56 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 64% identical to CSAA_BACSU: Probable chaperone CsaA (csaA) from Bacillus subtilis (strain 168)

KEGG orthology group: K06878, tRNA-binding protein (inferred from 100% identity to smk:Sinme_2384)

Predicted SEED Role

"Protein secretion chaperonin CsaA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N79 at UniProt or InterPro

Protein Sequence (113 amino acids)

>SMc04456 chaperone protein (Sinorhizobium meliloti 1021)
MTEIISYADFERVDIRVGTIVEAEPFPEARKPAIKLKIDFGPDIGIKKSSAQITVHYRPE
ELVGRQVLGVVNFPPRQIGPVRSEVLTLGFEDEAGAIVLASTDKPVPNGKKLM