Protein Info for SMc04396 in Sinorhizobium meliloti 1021

Annotation: periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 40 to 313 (274 residues), 112 bits, see alignment E=6.1e-36 PF13416: SBP_bac_8" amino acids 63 to 346 (284 residues), 63.5 bits, see alignment E=2.9e-21

Best Hits

Swiss-Prot: 100% identical to SP39_RHIME: Probable sugar-binding periplasmic protein (R03301) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to smk:Sinme_3293)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KZ7 at UniProt or InterPro

Protein Sequence (414 amino acids)

>SMc04396 periplasmic binding protein (Sinorhizobium meliloti 1021)
MRKFMTTTAVAALMLAATAARAAENVEVLHWWTSGGEAAALDVLKKDLESKGISWTDMPV
AGGGGTEAMTVLRARVTAGNAPTAVQMLGFDILDWAKEGALGNLDEVAAKEGWDKVVPAA
LQQFSKYDGHWIAAPVNVHSTNWVWINKAALDKAGAKEPTTWEELIALLDKFKEQGITPI
AHGGQPWQDATIFDAVVLSLGNDFYKQAFIDLDPAALGGDKMKEAFDRMTKLRSYVDDNF
SGRDWNLASAMVIENKAGLQFMGDWAKGEFLKAKKVPGTDFVCMRFPGTQGSVTFNSDQF
AMFKVSEDKVPAQLQMASAIESPAFQSAFNVVKGSVPARTDVPDTDFDACGKKGIKDLAE
ANTNGTLFGSMAHGHANPAAVKNAIYDVVTRQFNGELNSEEAVTELVAAVEAAK