Protein Info for SMc04394 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 279 (176 residues), 57.9 bits, see alignment E=5.7e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMc04394)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KZ9 at UniProt or InterPro

Protein Sequence (293 amino acids)

>SMc04394 ABC transporter permease (Sinorhizobium meliloti 1021)
MGAPNPENVISHNRLTRALIYSALILFALYSLLPLYVMLVNSLKPLDEIRQGGMLNLPQT
WTVEPWLSAWSTAQIGVQPTGLRPFFINSILMVVPAVAISTIIGALNGYVLTKWRFPGAN
IFFGMLLLSCFIPFQIVLIPMARILGILGIAGSIWGLILVHVVYGIGFTTLYFRNYYEAF
PTELVRAAQIDGASFFQIFRRILLPSSGPIIVVSVIWQFTNIWNDFLFGASFSGPYSTPM
TVALNNLVSSSTGVKEYNVHFAGAILAALPTLIVYIVSGRYFVRGLMSGAVKG