Protein Info for SMc04392 in Sinorhizobium meliloti 1021

Annotation: dehydrogenase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF00732: GMC_oxred_N" amino acids 201 to 298 (98 residues), 34.8 bits, see alignment E=1.5e-12 PF05199: GMC_oxred_C" amino acids 432 to 490 (59 residues), 54.6 bits, see alignment 1.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc04392)

Predicted SEED Role

"Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site" in subsystem Respiratory dehydrogenases 1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L01 at UniProt or InterPro

Protein Sequence (502 amino acids)

>SMc04392 dehydrogenase transmembrane protein (Sinorhizobium meliloti 1021)
MESQPDIVIIGSGVGGATVAAGLAASGAEILILEAGSHIEDLPVNRDQRAIFQRGHFRPK
ETWYEAGGPGFNPGNYYNVGGNSKFYGAVLTRYRREDFEEMQHRDGVSPAWPFSYEELEP
WYSRAEQLYQVRGKLGEDPTEPAHSSGYPHGPVPDEPAIAMVRERLAEIGLHPYSLPLGV
DIERWLAKGKTPWDAHPNSSDGKMDAETAALAAALKFPNVRLQTGSRVTRLVTGPDGKAI
ETVLYARDGAEHSLSPKLVILCAGAVQSAVLLLRSADDSNPTGLANRSDQVGRNFMNHNS
SAVIALSPWYRNDSVYQKTFGLNDFYLSDGAGGPPLGNVQLLGRISGAILKANMPAMPEW
LLNRVSARGIDFYAMSEDLPSPESRVMVDGERVVLKWVRTNWQAHLDLVARLKAVLKKAG
FPIVLARAFDKRTPSHQCGTVRIGNDPGQAPLDVYCRAFDHPNLFVVDAGFLPTSAAVNP
ALTVAAQALRVADHIVKQDLRP