Protein Info for SMc04350 in Sinorhizobium meliloti 1021

Annotation: multidrug efflux system transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 36 to 53 (18 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 65 to 399 (335 residues), 183.5 bits, see alignment E=2.6e-58 PF25917: BSH_RND" amino acids 89 to 244 (156 residues), 60 bits, see alignment E=4.3e-20 PF25876: HH_MFP_RND" amino acids 135 to 212 (78 residues), 42.8 bits, see alignment E=1.3e-14 PF25944: Beta-barrel_RND" amino acids 250 to 324 (75 residues), 48.7 bits, see alignment E=2e-16 PF25954: Beta-barrel_RND_2" amino acids 253 to 328 (76 residues), 29 bits, see alignment E=2.5e-10 PF25967: RND-MFP_C" amino acids 333 to 398 (66 residues), 25.5 bits, see alignment E=2.5e-09

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 100% identity to smk:Sinme_2047)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NV0 at UniProt or InterPro

Protein Sequence (421 amino acids)

>SMc04350 multidrug efflux system transmembrane protein (Sinorhizobium meliloti 1021)
MTREDEAARGSTPSNVTVIPAPVTPPRKKRRSRRPWIFALLVLAVVGTGYYAWSRQGAPP
ATTVITQAVTRGDIEESVTAVGTLDAVKSVDAGAQVSGQLKSLHVGIGDKVEQNQLIAEI
DPASIENRIEIDEAELANLEAQLVSKKAQLVLKQSNIERQRNLVATNSVSQSTLDQAVAD
HAAAGADVQAIEAQIRKQKATLAGDRVDLGYTKIYAPMAGTIVDDPAKEGQTLNANQTTP
TIVTIADLSTMTVKAQVSEADVGKLKLGMDAYFTLLGQPGKRFTGKLRQIEPMPDTENNV
VLYYALFDVPNPTGELMMSMSAQVFFVQAAAKNVLVVPSAALRTVEAAASDGPARAEVTV
VAPSGATQTRTVEVGVRNRVSAEIVSGLQEGEKVVVDAASATNGSRAPNATRRGMRMPPM
F