Protein Info for SMc04343 in Sinorhizobium meliloti 1021

Annotation: adenylate/guanylate cyclase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 220 to 238 (19 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details PF00211: Guanylate_cyc" amino acids 9 to 159 (151 residues), 40.2 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2043)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NV3 at UniProt or InterPro

Protein Sequence (317 amino acids)

>SMc04343 adenylate/guanylate cyclase transmembrane protein (Sinorhizobium meliloti 1021)
MPPTRRKLTTIFCADVQDYSRLMGKDEEGTLAALKRSRDAMARLIEAREGRVVNTWGDGV
IAEFPSVVEAVRAAIDVQNELAGLNAERHGEARMDYRIGLNLGDVIADGDDLYGDGVNIA
ARLQASAPAGGIVISSTVYDQVRNKLAVGFEFLGALTVKNIDGGVPSYVVQIGTAEGTVS
HKGGSDWGRPGALSDRGTPAADTGAGRATIVERTAAGRRLFGVLAVAAAAVVAVNLLSWE
GTFWARWPLFALALIGVLRCLWTSTRLDRGLALLGAAGFAVLAVNLLSWEGRFWAVWPLL
GIAVAAGIRWVTRRPVQ