Protein Info for SMc04331 in Sinorhizobium meliloti 1021

Annotation: dimethylamine corrinoid protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF02607: B12-binding_2" amino acids 17 to 89 (73 residues), 56.8 bits, see alignment E=2.1e-19 PF02310: B12-binding" amino acids 103 to 210 (108 residues), 83.7 bits, see alignment E=9.4e-28

Best Hits

Swiss-Prot: 37% identical to MTMC2_METMA: Monomethylamine corrinoid protein 2 (mtmC2) from Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)

KEGG orthology group: None (inferred from 99% identity to smd:Smed_1776)

MetaCyc: 81% identical to methionine synthase B12-binding subunit (Phaeobacter inhibens)
Methionine synthase. [EC: 2.1.1.13]

Predicted SEED Role

"Corrinoid methyltransferase protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.13

Use Curated BLAST to search for 2.1.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P19 at UniProt or InterPro

Protein Sequence (232 amino acids)

>SMc04331 dimethylamine corrinoid protein (Sinorhizobium meliloti 1021)
MADDEIILEDLSDEELVQQMHDDLYDGLKEEIEEGTRILLKRGWTPYDVLTQALVEGMRI
VGIDFRDGILFVPEVLLSANAMKAGMFILRPLLVETGAPKLGKMVIGTVKGDIDDIGKNL
VGMMMEGAGFDVVDLGINNPVENYLEALEREKPDILGMSALLTTTMPYMKVVIDTMKEKG
LRDEYVVLVGGAPLNEEFGKAVGADAYCRDAAVAVETAKDYMKRKHNQLAAG