Protein Info for SMc04316 in Sinorhizobium meliloti 1021

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 transmembrane" amino acids 127 to 148 (22 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 314 to 338 (25 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 415 to 440 (26 residues), see Phobius details amino acids 472 to 494 (23 residues), see Phobius details amino acids 503 to 528 (26 residues), see Phobius details amino acids 536 to 558 (23 residues), see Phobius details amino acids 590 to 611 (22 residues), see Phobius details amino acids 617 to 635 (19 residues), see Phobius details amino acids 644 to 668 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 194 to 384 (191 residues), 56.5 bits, see alignment E=1.6e-19 amino acids 487 to 669 (183 residues), 46.1 bits, see alignment E=2.5e-16

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to smk:Sinme_2031)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NV8 at UniProt or InterPro

Protein Sequence (678 amino acids)

>SMc04316 iron ABC transporter permease (Sinorhizobium meliloti 1021)
MPDTDEIARSRRRVPRTPAADPNAEGGSGLKMLGRPLRVMAKARSWRWLRFAFGGATEEG
AERSREPTRAPLPKALTRTLRGFEVPPSPYVTEDRSPKTNSSKAGTGWRAAYFRLRGQRM
SAGGEPAWLLALVFGAVFLLSALPLIRLGWAGIKGLEGGEAVRVLFEAATFAALRNTLIT
AAGGMAISLFVGALFAFVVALTDIRGKLALSFAFMLPMMIPPQVTALAWVEMSGPSSPLL
KTLGLAPPLGSPQPLYSLAGIALLLGVQHAPLVFLAVKAGLAAAPRDGVEAARLSGASPW
RVFRDIVLPLSSPGLIAGAAIAFVSGIGNFGIPAILGIPASIETLPTLIFSRFASFGSST
FGEIAVLSTLIALISAAGLLLQQRALKGRDYRLIGLAGARAAFTLGRLRIAAEALLWSIL
ALLLVAPLLALVASSLVPAYGVPLSFDTMSLNAYGEVLFRQSMTLTALKNSLFLASAAAV
GLLAVTIPAGYLLVTRRGRLASLLAILIEIPYALPGIVLAVAFILAFAAPLPLIGVSLYG
TIWIILAAYFPSFLAVSLKPVMSAFLQMDPSLEEAARLAGAGFLRRMRDVLLPLLAPAAG
ASVILVFLIAANELTVSALLWSAGTQTLGVAIFNLDDSGSSDLASALSVLVVVMVIGLMA
ALEFLAKYLPEGVLPWRN