Protein Info for SMc04286 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 62 to 83 (22 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details PF01925: TauE" amino acids 70 to 305 (236 residues), 168.6 bits, see alignment E=9.7e-54

Best Hits

Swiss-Prot: 83% identical to YCB9_SINSX: Probable membrane transporter protein ORF9 from Sinorhizobium sp.

KEGG orthology group: K07090, (no description) (inferred from 100% identity to smk:Sinme_1919)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P45 at UniProt or InterPro

Protein Sequence (319 amino acids)

>SMc04286 hypothetical protein (Sinorhizobium meliloti 1021)
MIVIFIGALQVGQTGLRHPRVAIRAATGSTSDNSLHFGVTSDTRRLKQFPPPYLLETPVH
DLALHILLFLFAAAFLAGFIDSIAGGGGMITIPAMLIAGIPPLETLGTNKLQSLFGSGSA
SIAYARHGHVNLREQLPMALMSAAGAVLGALLATVVPADVLEAVLPFLLIGIALYFGFKP
NIGDLDKHRRLSVFLFTITFVPLIGLYDGVFGPGTGSFFMLGFVSLAGYGILKATAHTKF
LNFGSNIGAFFVFLLSGVVLWKIGLTMGVGQFLGAQVGSRYAMAKGAKIIKPLLVVVSIA
LAIRLLADPEYPLRIWLRL