Protein Info for SMc04282 in Sinorhizobium meliloti 1021

Annotation: cobyrinic acid a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01656: CbiA
  • amino acids 4 to 187 (184 residues), 80.7 bits, E=1.4e-26
• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 5 to 424 (420 residues), 307.4 bits, E=8.6e-96
• PF07685: GATase_3
  • amino acids 243 to 425 (183 residues), 112.6 bits, E=2.9e-36

Best Hits

Swiss-Prot: 100% identical to COBB_RHIME: Hydrogenobyrinate a,c-diamide synthase (cobB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 100% identity to smk:Sinme_1916)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (30/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (12/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (26/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

See Q92P48 at UniProt or InterPro

Protein Sequence (429 amino acids)

>SMc04282 cobyrinic acid a,c-diamide synthase (Sinorhizobium meliloti 1021)
MNGLMIAAPSSGSGKTTVTLGLMRALRRRGLSIAPGKAGPDYIDPAFHTAASGKPCFNYD
PWAMRPELLLANAAAAAEDGSVLIMEAMMGLFDGAADGTGAPADLAAALGLAVILVVDCA
RLSHSVAALVGGYARHRDDVRVAGVILNRVGSDRHEGMLRDALAGIAMPVFGVLRQDAAL
KLPERHLGLVQAGEHGSLEAFIDHAAMRVASGCDLEAVLAAATPLTVGERAGTLKPLGQR
TAVARDVAFAFCYEHLLSGWRGQGAEVTFFSPLADEAPDPRADAVYLPGGYPELHAEQLS
NASNFRAAMHKAAGGGARVFGECGGYMVLGEGLVAADGGRYEMLGLLPLVTSFAERKRHL
GYRRVTPVDDVFFRGPMTAHEFHYATIVSEGAAEPLFTVRDAAGLDLGRAGLRRRNVAGS
FMHLIDFSE