Protein Info for SMc04279 in Sinorhizobium meliloti 1021

Annotation: cobalamin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details TIGR00380: cobalamin biosynthesis protein CobD" amino acids 7 to 310 (304 residues), 209.7 bits, see alignment E=3e-66 PF03186: CobD_Cbib" amino acids 9 to 305 (297 residues), 320 bits, see alignment E=6.4e-100

Best Hits

Swiss-Prot: 100% identical to COBD_RHIME: Cobalamin biosynthesis protein CobD (cobD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to sme:SMc04279)

MetaCyc: 76% identical to adenosylcobinamide-phosphate synthase (Pseudomonas denitrificans (nom. rej.))
Adenosylcobinamide-phosphate synthase. [EC: 6.3.1.10]

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P50 at UniProt or InterPro

Protein Sequence (327 amino acids)

>SMc04279 cobalamin biosynthesis protein (Sinorhizobium meliloti 1021)
MSAEILLILVIALLLDRVLGDPDWLWSRLTHPVVFFGKAVEYVDEALNRGEFTKAWLKFR
GVVGILVLLAGATALGVVLARLFDVLGALGSLLEVVTVAVFLAQKSLADHVSRVAAGLRR
DGLAGGREAVSMIVGRDPNTLDEPAVCRAAIESLAENFSDGVVAPAFWYAVAGLPGLLAY
KMLNTADSMIGHKSPKYLHFGWASARLDDLANLPAARLSALLIAAGAYFRRGAEAAKTAI
EVARRDHGLHRSPNSGWPEAAMAGATGVQLAGPRIYGGVKVDEPMMNDAGRAVAAIEDIE
AAVTVFYAACSVMTFAFAAAALPLLLF