Protein Info for SMc04258 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-Cellobiose and D-Salicin, permease component 2
Rationale: Specific phenotypes on D-Cellobiose; D-Salicin.
Original annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 287 (196 residues), 48.1 bits, see alignment E=5.9e-17

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_1899)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P65 at UniProt or InterPro

Protein Sequence (302 amino acids)

>SMc04258 ABC transporter for D-Cellobiose and D-Salicin, permease component 2 (Sinorhizobium meliloti 1021)
MTGLTRGSARPNQWLRNLNAKIASIPMILTAMVIFVGGTAWTVVYSFTNSKLLPRLAFVG
FDQYERLWAAPRWLVSIQNLAVFGCLSLVFSLVIGFVLAALMDQKIRFENTFRTIMLYPF
ALSFIVTGLVWQWLLNPQYGIQSIVRSLGWTSFSFDPLYNSNIVIYGILIAALWQGTGLV
MCLMLAGLRGIDEDIWKAARVDGIPMWKTYVLIIIPMMRGVFITTLVIIASGIVKVYDLV
VAQTSGGPGIASEVPAKYVYDYMFQAQNLGQGFAASTMMLVTVAIIIVPWAYLEFGGGRK
RG