Protein Info for SMc04215 in Sinorhizobium meliloti 1021

Annotation: cobalamin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to COBS_RHIME: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 100% identity to sme:SMc04215)

MetaCyc: 68% identical to adenosyl-cobalamin (5'-phosphate) synthase (Pseudomonas denitrificans (nom. rej.))
Adenosylcobinamide-GDP ribazoletransferase. [EC: 2.7.8.26]; 2.7.8.26 [EC: 2.7.8.26]

Predicted SEED Role

"Cobalamin synthase (EC 2.7.8.26)" (EC 2.7.8.26)

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (30/33 steps found)
superpathway of adenosylcobalamin salvage from cobinamide I (7/8 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (7/9 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (26/36 steps found)
2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (2/3 steps found)
benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
4-methylphenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
phenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
adenosylcobalamin biosynthesis from adenosylcobinamide-GDP II (1/4 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P97 at UniProt or InterPro

Protein Sequence (262 amino acids)

>SMc04215 cobalamin synthase (Sinorhizobium meliloti 1021)
MADIRELWDDVARSVAFLSRIPVPDRYFHGYDGGLGRAVRAFPLAAILITLPAAAIAFIL
GALHASSLFSAFLVVAVQAMVTGALHEDGLGDTADGFGGGRDRESALEIMKDSRIGTYGA
VALILSFGLRVSALAAFLPLLTPTGGGIALLATAALSRAAMVWHWSRLPPARRGGVAASA
GIPEPGATSVALGSGVLLALVLFFLAGIPTVAVWLSFAAFGLAVPGFTRIASRKLGGHTG
DTIGATQQLTEVAVLGALALAI