Protein Info for SMc04208 in Sinorhizobium meliloti 1021

Annotation: toxin secretion transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 15 to 436 (422 residues), 383.3 bits, see alignment E=7.9e-119 PF25994: HH_AprE" amino acids 93 to 282 (190 residues), 144.3 bits, see alignment E=5.1e-46 PF26002: Beta-barrel_AprE" amino acids 324 to 413 (90 residues), 103.3 bits, see alignment E=6.3e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2012)

Predicted SEED Role

"putative secretion protein (HlyD family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NX2 at UniProt or InterPro

Protein Sequence (436 amino acids)

>SMc04208 toxin secretion transmembrane protein (Sinorhizobium meliloti 1021)
MSSTEAEAVTRSIRRHLAIGMAVGLALIGAAGAWATTTQLAGAVVASGNFVVDSHVKKVQ
HPTGGVIGEILVEEGDWVKAGQVLMRLDPTQTKANLRIVTKRLDELMARLARLEAERDDR
GELEFPTELKVRAKERAVASAINGESKLFEYRRRSREGRRSQLLERIVQLQHEIAGLDAQ
QQAYDRGLSILDAEIASLRSLHERGIVSVQRLNELETRAATFEGLRGEKIAQQAQAAGRI
AETRLQILQIDEDLKTEVGRELREVQAQLGEFTERKIAAEDQLRRIDMLAPQGGIVHQLN
VHTVGGVISPADVVMSIVPDSDRLAIEARIRPQDIDQIQLGQDVVLRLSAFNQRTTPELG
GSVSRIAADLTEDPRSGLSYYVVRVAVPGAELARLGSLEPLPGMPAEAFIQTGQRTALSY
LIKPLSDQISRAFREE