Protein Info for SMc04207 in Sinorhizobium meliloti 1021

Annotation: toxin secretion ATP-binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 149 to 178 (30 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 20 to 562 (543 residues), 736.2 bits, see alignment E=1.1e-225 PF00664: ABC_membrane" amino acids 34 to 284 (251 residues), 75.8 bits, see alignment E=4.9e-25 PF00005: ABC_tran" amino acids 355 to 501 (147 residues), 104.6 bits, see alignment E=6.5e-34

Best Hits

Swiss-Prot: 53% identical to PRSD_RHIME: Type I secretion system ATP-binding protein PrsD (prsD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2011)

Predicted SEED Role

"cell processes; transport of large molecules; protein, peptide secretion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NX3 at UniProt or InterPro

Protein Sequence (617 amino acids)

>SMc04207 toxin secretion ATP-binding ABC transporter protein (Sinorhizobium meliloti 1021)
MFGNSKRTPPQLKAAAVIPAARTAFTGLAIISGIVNLLALTSPLFMLQVYDRVLASRSLP
TLVGLAVLATLMYGFQAMLEIVRSRALLRIGESFDHRLSGRVHAAIVRLPLETRMPGDGL
QPLRDLDNVRGFLAGAGPTALFDLPWMPLYLAICFLFHFWIGMTALVGALVLVAMTLLTD
RLSVQPTRDATRYGTDRNALMEAARRNAETVRALGLERHLQQRWLSANHLYLEANRRAAD
VAGAFGSVSRMLRMILQSAILGVGAWLVIEQQVSAGVMVASSIMMGRALAPVDLAIGSWK
PFLMARQSWDRLRNLLQLIPPAHPPMPLPAPKSILAVEGLTVIPPGSGGKPTVAGVSFSV
PAGGAIGIIGPSGSGKSTITRALVGAWTPASGKVRLDGASYEQWDREELGRHIGYLPQGV
ELFDGTIAENISRFENSPDPTAIVKAAQAAGVHDLIVRFEQGYETRIGEAGSALSAGQRQ
RIGLARALYNDPFLVVLDEPNANLDADGEKAVIDAILSVRNREGIAVVVAHRPSAIGAAD
LVLVVDSGQVNAFGPRDEVLSQVLKLPPRQNGDATPAAARSFSVSGRTLAPLKVVANTGT
EPTIAEAGDTENADVKH