Protein Info for SMc04204 in Sinorhizobium meliloti 1021

Annotation: iron transport regulator transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 117 to 140 (24 residues), see Phobius details PF16220: DUF4880" amino acids 46 to 88 (43 residues), 40.7 bits, see alignment 1.7e-14 PF04773: FecR" amino acids 144 to 235 (92 residues), 74.3 bits, see alignment E=8.8e-25

Best Hits

KEGG orthology group: K07165, transmembrane sensor (inferred from 100% identity to sme:SMc04204)

Predicted SEED Role

"Iron siderophore sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NX5 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SMc04204 iron transport regulator transmembrane protein (Sinorhizobium meliloti 1021)
MTNERSVHLKKADLSPVYLQSERDADYAQLDDGTMTPDDNAAELSKEATDWLIRIREAPD
DPEMRLHFERWVTTSRDHRREWEKTCRLWLSVGALPAARDKPSAHNFKPGRRGGRASLAI
AACAMAICLLVAWVPGLLIVLQSDYHTGTAETRSLELEDGSTVTLAPGSAIAMDFGQSRR
SLRLLQGEAYFDVAHDPARPFVVDAGGLEIEVLGTAFDVMVDSESTRVSLERGLVTASPS
GKEASAERRLTPGKALVFDRDAQDMTTSDIDAASIGAWRQGRLHVVNATISSVVERIQRY
HPAWISLPDPVLGSQRVTGIYDLTAPDEALGALVDPYGGKVRRISSFARVISRF