Protein Info for SMc04124 in Sinorhizobium meliloti 1021

Annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 43% identical to CDD_SPOPS: Cytidine deaminase (cdd) from Sporosarcina psychrophila

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 100% identity to sme:SMc04124)

MetaCyc: 40% identical to cytidine deaminase monomer (Homo sapiens)
Cytidine deaminase. [EC: 3.5.4.5]; 3.5.4.5 [EC: 3.5.4.5]

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
superpathway of pyrimidine ribonucleosides degradation (5/5 steps found)
pyrimidine deoxyribonucleosides degradation (3/3 steps found)
superpathway of pyrimidine ribonucleosides salvage (8/10 steps found)
superpathway of pyrimidine deoxyribonucleosides degradation (5/6 steps found)
pyrimidine ribonucleosides degradation (2/2 steps found)
pyrimidine ribonucleosides salvage II (2/2 steps found)
pyrimidine deoxyribonucleosides salvage (4/5 steps found)
pyrimidine ribonucleosides salvage I (1/3 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T52 at UniProt or InterPro

Protein Sequence (152 amino acids)

>SMc04124 cytidine deaminase (Sinorhizobium meliloti 1021)
MPPESAQRFRDNDMHNYKEKPMSKDELFVAAREAMAKAHAPYSKFPVGAAIRAEDGRIYT
GANIENLSFPEGWCAETTAISHMVMAGQRKITEVAVVAEKLALCPPCGGCRQRLAEFSGA
STRIYLCDETGIRKTLALSDLLPHSFETEILG