Protein Info for SMc03987 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 231 (221 residues), 35.7 bits, see alignment E=7.1e-13 amino acids 204 to 390 (187 residues), 75.7 bits, see alignment E=5e-25 PF05977: MFS_3" amino acids 234 to 394 (161 residues), 28.1 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2826)

Predicted SEED Role

"TRANSPORTER, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M74 at UniProt or InterPro

Protein Sequence (433 amino acids)

>SMc03987 transport transmembrane protein (Sinorhizobium meliloti 1021)
MRNNLLPVAALLLGTLFLFLGNGLQGLLLPVRGTAEGYPTTILGLFGTLWATGFVLGCFF
APNVVKRIGHVRAFSVFTALIAIVSLLTGILIDPIWWLALRAVTGFSTAGTSMIIESWLN
ERATNESRGVIFSLYIAITLFGVVGGQMMIPFGETSTTFFFMICGILYCVAMLPTLLSRA
ASPQPLKQVRLDLRGLYRNSPVSFLGILLIGIANGAFGTLGAVFGRQAGLSDSTVAAMMS
VAIFSGAVMQLPAGRISDRIDRRYVLAALAGVGALAGLLIFLVEPGQVWIVLTLIAIYGA
AANALYPIAVSHANDFATPEDFVKVSGGLLLLYGIGTIIGPTIGGPIMTASGPYGLFMIT
ACAHMLITAYAIVRSRRRAPVPAAERENFSPVNAGTATTPESLQLSPRAAPLEELPDEGA
DDPQEEERSNEPV