Protein Info for SMc03975 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 224 to 243 (20 residues), see Phobius details PF00126: HTH_1" amino acids 19 to 77 (59 residues), 76.8 bits, see alignment E=9.7e-26 PF03466: LysR_substrate" amino acids 102 to 295 (194 residues), 76.2 bits, see alignment E=2.5e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc03975)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M83 at UniProt or InterPro

Protein Sequence (313 amino acids)

>SMc03975 transcriptional regulator (Sinorhizobium meliloti 1021)
MPVIKFSYGDSMSTPLDSDLLRTFLAVADTGNLTRAADTVRRTQSAVSMQIRKLEELIGS
ALFERHSRGVILTDDGRRLADNARRIVSLLDDTAAAMRSPALEGSVRIGISEEYVNSTLP
KALGAFAAIHPGVEVTVRQETSMANSAALAAGELDIAVVFEPGGRSRNEVLMVNPTVWAT
CDQHGAHERRPVPIATYTYAEGGWCDELARRSLQSRGIESRIAYVSRTSGGLIAALISGL
AIAPLSRTAIPAGCRELTEEDGFGIIDMTNVVLRTRRGNRSPTVDAMADAIRRAFRAPAE
KEKEEVRSTTTDG