Protein Info for SMc03889 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 202 (194 residues), 62.9 bits, see alignment E=1.3e-21 amino acids 221 to 367 (147 residues), 37.9 bits, see alignment E=5.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3268)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L18 at UniProt or InterPro

Protein Sequence (379 amino acids)

>SMc03889 transporter (Sinorhizobium meliloti 1021)
MSKNRLAVSLLFLMNGFVTGSWAPKIPEFKERLGIGESVLGLLILGFGIGSLVLMPIAGG
FIARLGSQKVVKVTAIILSPLLLLLTLLPNLWTAALGMFLLGGFVGAMDVAMNANAVEVE
KSMRRAIMSSCHAYWSLGGLIGAGIGGFLMARFGVLPHAIVVTCLCLAILAVAWPMILAD
RPHPAATREKLRLPMTPLPWLIGIMALFSMVPEGAVLDWGALYLKDELGASVELSGFGFA
AFSATMAAMRFAGDHVRDRLGATLTLRICTVTALAGMVLAGLAPNAVLAILGFALAGIGI
SNMVPIAFSAAGNMPGLQPGIGLSVATTMGYSGMLFAPSLIGFIAEHSGFAIIFACVPVL
FIVVLLLSHHAVHADHSKG