Protein Info for SMc03856 in Sinorhizobium meliloti 1021

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR00652: diaminopimelate epimerase" amino acids 11 to 281 (271 residues), 208.2 bits, see alignment E=7.9e-66 PF01678: DAP_epimerase" amino acids 12 to 129 (118 residues), 63.2 bits, see alignment E=1.3e-21 amino acids 164 to 278 (115 residues), 88 bits, see alignment E=2.5e-29

Best Hits

Swiss-Prot: 100% identical to DAPF_RHIME: Diaminopimelate epimerase (dapF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to sme:SMc03856)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L46 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SMc03856 diaminopimelate epimerase (Sinorhizobium meliloti 1021)
MDQRDMGDQVQFARMNGLGNKILVVDMRGRKDRVTPQAAIALNADPATEFDQIMAIHDPK
SAGTDAWIDIVNSDGSMAQACGNGTRCVVQALAAETGRKAFLFHTVAGLLEAKEHDNGTI
SVDMGKPRFGWDQIPLAEEFHDTRRIELQIGPIDAPVLHSPSVASMGNPHAIFWVENDVW
SYELDRFGPLLENHPIFPERANISIARIRSRQEMDLRTWERGAGLTLACGSAACAAAVNG
ARTGRTERMVTVNVPGGPLKIEWRERDDHVIMTGPAEWEWSGTVDPVTGIFARNEPESGD
NGARAL