Protein Info for SMc03853 in Sinorhizobium meliloti 1021

Annotation: intracellular septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 111 to 138 (28 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details PF04279: IspA" amino acids 17 to 205 (189 residues), 202.8 bits, see alignment E=2.6e-64 TIGR00997: intracellular septation protein A" amino acids 17 to 207 (191 residues), 179.8 bits, see alignment E=2.9e-57

Best Hits

Swiss-Prot: 100% identical to YCIB_RHIME: Probable intracellular septation protein A (R03236) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06190, intracellular septation protein (inferred from 100% identity to sme:SMc03853)

Predicted SEED Role

"Probable intracellular septation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L49 at UniProt or InterPro

Protein Sequence (210 amino acids)

>SMc03853 intracellular septation protein A (Sinorhizobium meliloti 1021)
MSTIEAAKPKTEVSPLLKLVLELGPLMVFFFANSRGEWLAGRFPALAELGGPIFIATGLF
MAATAAALIASWIMTRTLPMMPLVSGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGAIL
LGGLLFGKSLLGYVFHAAFKLDEEGWRKLTIRWGVFFLFLAVLNEVIWRSFSTDFWVAFK
VWGTMPITILFTLAQMPLIMKHSLEQDSAE