Protein Info for SMc03851 in Sinorhizobium meliloti 1021

Annotation: thiol:disulfide interchange protein (cytochrome C biogenesis protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 23 to 197 (175 residues), 192.7 bits, see alignment E=1.9e-61 PF00578: AhpC-TSA" amino acids 54 to 176 (123 residues), 37.9 bits, see alignment E=3.1e-13 PF08534: Redoxin" amino acids 82 to 186 (105 residues), 56.4 bits, see alignment E=6.3e-19 PF13905: Thioredoxin_8" amino acids 86 to 174 (89 residues), 33.8 bits, see alignment E=7.2e-12

Best Hits

Swiss-Prot: 57% identical to CYCY_BRADU: Thiol:disulfide interchange protein CycY (cycY) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 100% identity to sme:SMc03851)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L51 at UniProt or InterPro

Protein Sequence (202 amino acids)

>SMc03851 thiol:disulfide interchange protein (cytochrome C biogenesis protein) (Sinorhizobium meliloti 1021)
MTDAETPQDERRPGALRYLMAALPLLIFAVLALIFWSQLNSGRDVSEIPSALIGTKAPML
AMPPLEGAATPSGEPMPALDDAAVKGKLTLVNVWASWCVPCRQEHPIILELSKDPRLNVV
GINYKDRNENALRFLGELGNPFSAIGVDPNGKAAINWGVYGIPESFLVAADGTILYKRAG
PFDEKSLREGLMPAIEKALAGS