Protein Info for SMc03847 in Sinorhizobium meliloti 1021

Annotation: cytochrome c biogenesis protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 3 to 202 (200 residues), 235.4 bits, see alignment E=2.3e-74 PF00005: ABC_tran" amino acids 18 to 160 (143 residues), 93.6 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 100% identical to CCMA_RHIME: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 100% identity to sme:SMc03847)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L55 at UniProt or InterPro

Protein Sequence (207 amino acids)

>SMc03847 cytochrome c biogenesis protein CcmA (Sinorhizobium meliloti 1021)
MRLMAEGLSARRGEDLIFNDISFALAAGEALVVTGPNGAGKSTLLRVLAGLLEPEGGRVR
LEDGPSGFEHPRELSHYLGHRNAMKRELTVEENLTFWQRFLGDSPGGSGIGLVEAAEAVG
LADIIHLPFGYLSAGQQRRMAMAKLIVAFRPIWLLDEPTAALDLSADRLFAGLVAAHLDR
GGIVVAATHQPLGFAGAKSLEMTGFVH