Protein Info for SMc03808 in Sinorhizobium meliloti 1021

Annotation: cell division transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 881 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 156 to 185 (30 residues), see Phobius details PF13491: FtsK_4TM" amino acids 26 to 169 (144 residues), 64.7 bits, see alignment E=1.8e-21 PF17854: FtsK_alpha" amino acids 379 to 480 (102 residues), 96.1 bits, see alignment E=2.5e-31 PF01580: FtsK_SpoIIIE" amino acids 488 to 707 (220 residues), 246.5 bits, see alignment E=4.4e-77 PF09397: FtsK_gamma" amino acids 813 to 872 (60 residues), 92 bits, see alignment 3.2e-30

Best Hits

Swiss-Prot: 100% identical to FTSK_RHIME: DNA translocase FtsK (ftsK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to smk:Sinme_3187)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L89 at UniProt or InterPro

Protein Sequence (881 amino acids)

>SMc03808 cell division transmembrane protein (Sinorhizobium meliloti 1021)
MSRSNTATLDSRSNRFVLTHFVWRQIASLAGFVLVGALALAIAALSTWNVADPSFSYATS
NEPTNLLGYGGAVFADIFMQFFGLASVVALLPAVAWALVLIRGTHFDKVLKRLGLWFAGS
VLASAALSCVPAPITWPLPNGLGGVFGDMILRFPALFTGTFPTGTFATVLACLFTAPAAW
CLVYSAGLIGVSEDEEAEPAPEPAPSKARTIRDELEEEDEEGPLTVLMGSLAHMRYTAQA
RLRRAFGMGAKPAKRQYDEPYDFNNDEFGTLNEPVRPKAQAGRIEPSLDRSERRIVTPPP
IMGDEDDPPFDIDERRPAGILPDDDEDDVAADWAPRPAPPKPALAMAGSRVAPPRPKAGQ
RVEREAQRSFVDEDGDFTLPPIHFLAEPKNVARDASLSADALEQNARMLEGVLEDFGVKG
EIIHVRPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAIAARVAVVPGRNAIGIELPN
QRREMVYLRELIGSRDFETTKTKLAMALGKTIGGESVVADLAKMPHLLVAGTTGSGKSVA
INTMILSLLYRLRPDQCRLIMIDPKMLELSVYDGIPHLLSPVVTDPKKAVVALKWTVREM
EERYKKMSKIGVRNIDGFNSRVEQALAKGEAITRTVQTGFDRQTGEAVYETEEFDLSPMP
YIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAAGIHVIMATQRPSVDVITGTIKANFPT
RISFQVTSKIDSRTILGEQGAEQLLGMGDMLYMAGGGRIQRVHGPFVSDTEVEEVVAYLK
TQGVPQYLDAITEDDEDENDGGGPAGTSNLADSEDPYDQAVAIVLRDGKASTSYVQRRLG
IGYNRAASLIERMEQEGIISPANHAGKREILVPTEAEITGR