Protein Info for SMc03807 in Sinorhizobium meliloti 1021

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 45 to 448 (404 residues), 426.6 bits, see alignment E=4.9e-132 PF00909: Ammonium_transp" amino acids 48 to 448 (401 residues), 385.1 bits, see alignment E=1.7e-119

Best Hits

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 100% identity to smk:Sinme_3186)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L90 at UniProt or InterPro

Protein Sequence (451 amino acids)

>SMc03807 ammonium transporter (Sinorhizobium meliloti 1021)
MSSFTLSTSLRRVGATAAAMLAPVVAFAQEAAPAAAATPVPDKADTTFMFLSTLLVLFML
IPGLALFYGGLVRAKNMLSVLMQCTVIGAAMMIVWVVYGYSFAFGGSTSAYFGGFAKLFL
AGVTVDSTAATFSDGVVIPEYLFMLFQMTFAAITPALIVGAFAERIKFSAAILFAILWAT
FVYFPIAHMVWDANGLLFGMGALDFAGGTVVHINAGVAGLVGAFMVGKRTGYGRDMMAPH
SMTLTLVGAAMLWFGWFGFNAGSNLEASGGAVLATVNTFLATAAAVLSWSLVETLTRGKA
SMLGAASGMIAGLVAVTPAAGIAGPMGAIIMGLIVSPLCYFFVSVIKNKFHYDDTADVFG
VHGVGGFFGAIATGVFASSSLGGIGYADGVTMGSQLMTQITAVAITIVWCGVVSAILYKV
VDALVGLRVSMEAEREGLDLSSHGEAAYHAS