Protein Info for SMc03243 in Sinorhizobium meliloti 1021

Annotation: alkaline phosphatase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF16655: PhoD_N" amino acids 44 to 135 (92 residues), 84.3 bits, see alignment E=6.9e-28 PF09423: PhoD" amino acids 147 to 501 (355 residues), 293.5 bits, see alignment E=2.3e-91

Best Hits

KEGG orthology group: K01113, alkaline phosphatase D [EC: 3.1.3.1] (inferred from 100% identity to smk:Sinme_3145)

Predicted SEED Role

"secreted alkaline phosphatase" in subsystem Phosphate metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.1

Use Curated BLAST to search for 3.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LG7 at UniProt or InterPro

Protein Sequence (520 amino acids)

>SMc03243 alkaline phosphatase transmembrane protein (Sinorhizobium meliloti 1021)
MAALRNTLTRRSFLFSAGAAGLVASSGLATPFYARGYGRPEFAHGVQSGDVDTGSGMIWT
RVDRPARVSVEYSTTESFSNAVRLADIDATPLTDCAVKCRLHNLLPDQDIFYRFIATDLY
DANRVSEPVVGRFRTAPLRRRSVRFVWSGDTAGQGWGIDEVGMKTYSTMRLHEPDFFIHS
GDTIYADNPIPDEIKLRDGGMWKNRIVTPEKRDVARTLEEYRGQWKYNLLDEHVRRLHAE
CPTFYQWDDHEVLNNWSASTDLSDDPRYPEKDVAVYAARAARAFHEMTAIRTLPTEPGRI
FRKIAYGPLLDVFFVDLRSYRGPNQEEGGGGLFGWRQADWLKRELAASSATWKVIACDMP
IGLIVWDDYSARRGSDAIADGDHGAPKGRESEFADLLRFVRDNAIENLVWLTADVHYTAA
HHYDPSRAAFKDFSPFWEFVSGPLHSGTYGPKELDMTFGPEVRFMKASGGGIDSNLPPSA
GLQFFGIVDISGQTRQMTVRLMDRQDQELWRVTLDPAVSA