Protein Info for SMc03211 in Sinorhizobium meliloti 1021

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 100% identity to smk:Sinme_2998)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

L-tyrosine degradation I (5/5 steps found)
plastoquinol-9 biosynthesis I (1/3 steps found)
superpathway of plastoquinol biosynthesis (2/5 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.27

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LT1 at UniProt or InterPro

Protein Sequence (370 amino acids)

>SMc03211 4-hydroxyphenylpyruvate dioxygenase (Sinorhizobium meliloti 1021)
MGPFPHDAPPPAISAENPAGTDGFEFVEFAHPEPEKLAELFGRMGYTPIARHKTKDITVW
RQGDINYVLNAQAGSHAMRFVGEHGPCAPSMAWRVVDAKHAFEHAVAKGAEAYTGNNKCL
DVPAIVGIGGSLLYFVEAYGEKGSAYDAEFEWLGERDPKPPGVGFYYLDHLTHNVYRGNM
DKWWAFYRELFNFKQIHFFDIDGRITGLVSRAITSPCGKIRIPLNESKDDTSQIEEYLKK
YKGEGIQHIAVGTEAIYDATDKLAENGLKFMPGPPETYYEMSHQRVHGHDEPIDRMRTHG
ILIDGEGVVNGGMTKILLQIFSRTVIGPIFFEFIQRKGDEGFGEGNFRALFESIEADQIR
RGVLGHEAAE