Protein Info for SMc03208 in Sinorhizobium meliloti 1021

Annotation: homogentisate 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR01015: homogentisate 1,2-dioxygenase" amino acids 20 to 446 (427 residues), 750 bits, see alignment E=3.4e-230 PF20510: HgmA_N" amino acids 21 to 293 (273 residues), 428 bits, see alignment E=1.5e-132 PF04209: HgmA_C" amino acids 294 to 446 (153 residues), 267.9 bits, see alignment E=2.4e-84

Best Hits

Swiss-Prot: 100% identical to HGD_RHIME: Homogentisate 1,2-dioxygenase (hmgA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00451, homogentisate 1,2-dioxygenase [EC: 1.13.11.5] (inferred from 100% identity to smk:Sinme_2995)

Predicted SEED Role

"Homogentisate 1,2-dioxygenase (EC 1.13.11.5)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 1.13.11.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9X4F5 at UniProt or InterPro

Protein Sequence (453 amino acids)

>SMc03208 homogentisate 1,2-dioxygenase (Sinorhizobium meliloti 1021)
MLEKAEKQRRAGSGQQRAAGYMPGFGNDFETESLPGALPQGQNSPQKCNYGLYAEQLSGS
PFTAPRGTNERSWLYRIRPSVRHTGRFRRVDYPHWKTAPHVGEHSLALGQLRWSPLPAPS
EALDFLQGIRTMTTAGDALTQAGMAAHAYAFNADMVDDYFFNADGELLIVPETGAIQVFT
ELGRMDVEPSEICLIPRGMMFKVTRLGEEKVWRGYICENYGAKFTLPDRGPIGANCLANP
RDFKTPVAAYEDKETPCRVQVKWCGSFHMVEIGHSPLDVVAWHGNYAPYKYDLKTFSPVG
AILFDHPDPSIFTVLTAPSGEEGTANVDFVIFPPRWLVAEHTFRPPWYHRNIMSEFMGLI
YGRYDAKEEGFVPGGMSLHNMMLAHGPDFSGFEKASNGELKPVKLDNTMAFMFETRFPQQ
LTTFAAELDTLQDDYMDCWSGLERKFDGTPGIK