Protein Info for SMc03204 in Sinorhizobium meliloti 1021

Updated annotation (from data): Dihydrolipoyl dehydrogenase (EC 1.8.1.4)
Rationale: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (1.8.1.4) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01350: dihydrolipoyl dehydrogenase" amino acids 7 to 464 (458 residues), 500.8 bits, see alignment E=1.8e-154 PF07992: Pyr_redox_2" amino acids 7 to 326 (320 residues), 234.2 bits, see alignment E=6.6e-73 PF01134: GIDA" amino acids 8 to 55 (48 residues), 21.8 bits, see alignment 2.7e-08 PF00070: Pyr_redox" amino acids 179 to 249 (71 residues), 70.7 bits, see alignment E=3.6e-23 PF02852: Pyr_redox_dim" amino acids 345 to 454 (110 residues), 118.1 bits, see alignment E=6.7e-38

Best Hits

Swiss-Prot: 46% identical to DLDH1_GEOSE: Dihydrolipoyl dehydrogenase (pdhD) from Geobacillus stearothermophilus

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to smk:Sinme_2991)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LT6 at UniProt or InterPro

Protein Sequence (464 amino acids)

>SMc03204 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) (Sinorhizobium meliloti 1021)
MKEISCKLLVLGAGPGGYVAAIRAGQLGVNTVIVEKAKAGGTCLNVGCIPSKALIHAADE
YHRLRAAASGKGPLGLSLSAPAIDLRRTIAWKDGIVGRLNGGVTGLLKKAGVKAVIGEGR
FVDGKTVDVETETGLQRIRAEAIVIATGSAPVELPDLPFGGSVISSTQALALTDVPQTLA
VIGGGYIGLELGTAFAKLGSKVTVLEALDRILPQYDADLSKPVMKRLGELGVEVFTRTAA
KRLSADRRGLLAEENGRAFEVPAEKVLVTVGRRPVTDGWGLEEIDLDHSGRFIRIDDQCR
TSMRGVYAIGDVTGEPMLAHRAMAQGEMVAEIVAGHKRSWDKRCIPAVCFTDPEIVGAGL
SPEEARAAGIDVKIGQFPFQANGRAMTTLSEDGFVRVIARADNHLVLGIQAVGHGVSELS
ATFALAIEMGARLEDIAGTIHAHPTQSEAFQEAALKTLGHALHI