Protein Info for SMc03193 in Sinorhizobium meliloti 1021

Annotation: cobalamin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR02435: precorrin-3B synthase" amino acids 19 to 394 (376 residues), 347.6 bits, see alignment E=4.4e-108 PF03460: NIR_SIR_ferr" amino acids 29 to 94 (66 residues), 53.9 bits, see alignment E=6e-19

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 100% identity to sme:SMc03193)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LU7 at UniProt or InterPro

Protein Sequence (455 amino acids)

>SMc03193 cobalamin biosynthesis protein (Sinorhizobium meliloti 1021)
MTSCAAPRADRSATGTSMRRGSCPSLAAPMQTGDGLLVRLRPAGDGLTPAEMRAIAGAAA
RCGSGVIEVTARGNLQIRGLTPESVPALAEAIGAAEIAIAEGVAIETPPLAGFDPDEIAD
PRPLARALRVAISGAGEALRLAPKLSIVVDGGGRFHLGSLTADLRVSALAHEGGVRWLFS
LGGTARSAKPVALLESKDIVPMVLEILGDLTARGPASRARELDADLLRQRAAAGDALPRV
DGPVFSPPPAGIHHFGGAGTVLGIGLAFAQTDAGSLVAFLRQAEELGANEIRLAPPHGLF
VLGLSGETAAVAQRLASAHGFLVASGDPRNHIATCAGLACASARMDTKAMARLLLEAAPD
LLDGSATVHLSGCPKGCASPTASPLTLVGAPSGYALVVNGTASVAPSAYRDENGIGSAFG
ALNALVRENKDAGESALSCLTRLGTARIAAAFEQG